General Information

  • ID:  hor006350
  • Uniprot ID:  Q9Y5Q6
  • Protein name:  Insulin-like peptide INSL5 B chain
  • Gene name:  INSL5
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Highly expressed in rectum with lower levels in uterus and ascending and descending colon.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0008150 biological_process; GO:2000253 positive regulation of feeding behavior
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  KESVRLCGLEYIRTVIYICASSRWRR
  • Length:  26(23-48)
  • Propeptide:  MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
  • Signal peptide:  MKGSIFTLFLFSVLFAISEVRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP4
  • Target Unid:  Q8TDU9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9Y5Q6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006350_AF2.pdbhor006350_ESM.pdb

Physical Information

Mass: 360482 Formula: C139H229N43O37S2
Absent amino acids: DFHMNPQ Common amino acids: R
pI: 10.04 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -15.77 Boman Index: -6650
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 101.15
Instability Index: 7590 Extinction Coefficient cystines: 8605
Absorbance 280nm: 344.2

Literature

  • PubMed ID:  10458910
  • Title:  Identification of INSL5, a new member of the insulin superfamily.
  • PubMed ID:  12975309
  • Title:  The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
  • PubMed ID:  16710414
  • Title:  The DNA sequence and biolo
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  15340161
  • Title:  
  • PubMed ID:  15525639
  • Title:  
  • PubMed ID:  18576448
  • Title:  
  • PubMed ID:  19178384
  • Title: